PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017174P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 215aa    MW: 24803.2 Da    PI: 8.8802
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017174P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.44.3e-263484252
          RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    +k +s +++s+yF++pi+ AAkeL+v+lT+LK++CR++GI+RWPhRk+ s+
  MELO3C017174P1 34 SKMLSKKVISEYFYMPITRAAKELNVGLTLLKKRCRELGIRRWPHRKLMSI 84
                    57899*******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.49517106IPR003035RWP-RK domain
PfamPF020424.4E-213784IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVVHNKKGKK RSKCLKSENV CSNNSNNGSC YSSSKMLSKK VISEYFYMPI TRAAKELNVG  60
LTLLKKRCRE LGIRRWPHRK LMSIQTLIKN VKEIEKGDEE EGNGSENCKL KNVLEILENE  120
KKLMEERPDL QLEDNTKRLR QACFKANYKK RKLSGLIINN NSNNNNNIDD INSQNYFSSS  180
TTTIDNQDDH DDYDEEMKYL LSDCSFSSTN CMFM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453676.11e-152PREDICTED: protein RKD1-like
SwissprotQ9M9U99e-54RKD1_ARATH; Protein RKD1
TrEMBLA0A0A0LP422e-94A0A0A0LP42_CUCSA; Uncharacterized protein
STRINGVIT_17s0000g06250.t016e-65(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-53RWP-RK domain-containing protein